PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim09g091880.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 290aa    MW: 32265.6 Da    PI: 6.103
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim09g091880.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1092.5e-3451105155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kprlrWt+eLHerFv+av+qLGG+ekAtPkti+++m+vkgLtl+h+kSHLQkYR+
  Sopim09g091880.0.1  51 KPRLRWTTELHERFVDAVTQLGGPEKATPKTIMRTMGVKGLTLYHLKSHLQKYRM 105
                         79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.05948108IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.9E-3349106IPR009057Homeodomain-like
SuperFamilySSF466894.84E-1750107IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-2451106IPR006447Myb domain, plants
PfamPF002497.2E-953104IPR001005SANT/Myb domain
PfamPF143799.8E-27149195IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MYSTLPIRNL VIEENGDFFN HHMNHNLQAS LSVDGTNLPG DSCLVLSTDP KPRLRWTTEL  60
HERFVDAVTQ LGGPEKATPK TIMRTMGVKG LTLYHLKSHL QKYRMGKQSA KEATENSKDV  120
SCPAESQETG SSTSGSSRVI VQDINEGLQV TEALRVQMEV QQRLHEQLEV QRHLQLRIEA  180
QGKYLQSILE KACKAFNSQS LELNGLEMNR EELSELAFIN GPSLPDIGPS FENKNACNIP  240
AMLGDCLLDD CLPSNGISSL KKRPRGFTNV NGLPMESNTR EVEWMMSNI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755210.0HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004247854.10.0PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK51e-66APL_ARATH; Myb family transcription factor APL
TrEMBLK4CWL40.0K4CWL4_SOLLC; Uncharacterized protein
STRINGSolyc09g091880.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-103G2-like family protein